Buy and Sell United States classifieds, United States ads, United States classified ads, garage sale United States Page number 952-96

Find
 


Classifieds: Buy and Sell

This is the Buy and sell new & used goods in United States classifieds category. For Sale United States covers antiques, collectibles, cameras, electronics, phones, PDA, computers, accessories, furniture, books, magazines, jewellery, jewelery, watches, hobbies, crafts, musical instruments, home appliances, home, garden, clothing, accessories, sporting goods , bicycles, baby, kids, toys and games , garage sales, tickets , free stuff, barter, swap and general for sale in United States and vicinity.

Please find below classifieds in category Buy and Sell category in United States. Please use the form above to refine your search in Buy and Sell in United States. If you can not find what you need in United States please add your wanted ad to let sellers contact you. If you want to keep your contact info confidential enter only your email address so you will receive offers into your account in our system. You can click Post a classified ad link below or the button Post classified for FREE in top right corner of this page to post your classified ad in category Buy and Sell in United States. It is fast, easy and free to post an ad in FREEADSinUS.com. It will take you just few minutes to have the ad available on our listings. You can edit your ads any time by clicking “Edit my ads" button on top right corner of this page.


Post FREE classifieds for Buy and Sell


   Order by
French Colonial Buffet Lamp!
30-08-2008 00:16 by Oodle via Oodle.com Price: 49.95 USD $
Offering: Furniture for sale in United States, Texas, Amarillo ... View detailed ...
French Colonial Buffet Lamp!

French Colonial Buffet Lamp French Colonial design buffet lamp. 64" UL Recognized cord. Metal stand. 4" X 4" X 30 1/2" H. Shade is 11" diameter Exclusive. Visit Us At www.Thomastreasurestx.com.

 
Baroque-Style Lamp!
30-08-2008 00:12 by Oodle via Oodle.com Price: 49.95 USD $
Offering: Furniture for sale in United States, Texas, Amarillo ... View detailed ...
Baroque-Style Lamp!

Baroque Gold Foil Lamp with Shade With elaborate designs distinctive of Baroque-style furnishings, this lamp will be a graceful addition to your home. Gold foil alabastrite base with gold fabric shade. 25" high. Visit Us At www.Thomastreasurestx.com.

 
Antiqued Scroll-Motif Table Lamp!
30-08-2008 00:08 by Oodle via Oodle.com Price: 59.99 USD $
Offering: Furniture for sale in United States, Texas, Amarillo ... View detailed ...
Antiqued Scroll-Motif Table Lamp!

Antiqued-Style Scroll-Motif Table Lamp Scroll, leaf, and "wicker" details appear on this table lamp, which has the look of a cherished antique. Alabastrite base in bronze and gold finishes. UL Recognized. Base: 23" high. Shade: 12" diameter. Visit Us At www.Thomastreasurestx.com.

 
Hanging Pendant Vase!
29-08-2008 23:01 by Oodle via Oodle.com Price: 19.98 USD $
Offering: Home, garden in United States, Texas, Amarillo ... View detailed ...
Hanging Pendant Vase!

Hanging Pendant Vase Alongside an entryway or lining a hall, this graceful free-swinging pendant vase lends designer distinction to any wall! Black scrollwork wall bracket sturdily supports a sparkling glass hanging vase, adding renaissance romance wherever you choose to display it. Visit Us At www.Thomastreasurestx.com.

 
Jordan 6 Rings
29-08-2008 22:44 by sell.com via Oodle.com Price: 69.98 USD $
Offering: Clothing for sale, accessories in United States, Pennsylvania, Wyomissing ... View detailed ...
Jordan 6 Rings

Brand new Jordan 6 Rings Sizes are 8, 8.5, 9.5, 10, 11, 12, 13 Many colors to chose from Shipping is through ems shipping company and usps shipping company delivery time is 5 to 9 days anywhere in the world. Payment I accept is paypal pay to Follow the link above to my website and you can buy directly through there and also there are many more Jordans to chose from.

 
Make Money Giving Away Free Marketing Systems If you would
29-08-2008 22:00 by EPage via Oodle.com
Offering: Free stuff in United States, New Mexico, Albuquerque ... View detailed ...

Make Money Giving Away Free Marketing Systems If you would like to earn money from home my step-by-step video tutorials will walk you through the set up of your very own home-based business which includes 12 streams of income. For more information simply listen to the video introduction:.

 
COMPLETE KITCHEN All cabinets & sink, $700.
29-08-2008 17:01 by Hot-Ads Classified Ads via Oodle.com Price: 700 USD $
Offering: Furniture for sale in United States, Pennsylvania, Lewistown ... View detailed ...

COMPLETE KITCHEN All cabinets & sink, $700. 6 appliances $900; all for $1500. 717-436-XXXX.

 
If loving gnomes is wrong, then I don't wanna be right Sure
29-08-2008 15:43 by Etsy via Oodle.com Price: 10 USD $
Offering: Antiques for sale, collectibles for sale in United States, Georgia, Tifton ... View detailed ...
If loving gnomes is wrong,  then I don't wanna be right Sure

If loving gnomes is wrong, then I don't wanna be right Sure the Warhol look has been done a few times. But with garden gnomes? They look super cool and ready to party. These gnomes would look great in a child's room. This version of the gnomes print is do to a mess up at the printers. Instead of keeping the image a perfect square, they enlarged it to fit the 8 1/2" by 11" paper with a white border.

 
This is an ACEO, # 2 of 25 edition, printed on heavy
29-08-2008 12:27 by Etsy via Oodle.com Price: 2 USD $
Offering: Antiques for sale, collectibles for sale in United States, Texas, Amarillo ... View detailed ...
This is an ACEO,  # 2 of 25 edition,  printed on heavy

This is an ACEO, # 2 of 25 edition, printed on heavy cardstock, it is 2.5 x 3.5 inches, Title: Big GUY Watermark will not be on your card. The original watercolor painting is now in a private collection.

 
This is a ACEO #2 of 25 edition of a watercolor enhanced
29-08-2008 12:09 by Etsy via Oodle.com Price: 2 USD $
Offering: Antiques for sale, collectibles for sale in United States, Texas, Amarillo ... View detailed ...
This is a ACEO #2 of 25 edition of a watercolor enhanced

This is a ACEO #2 of 25 edition of a watercolor enhanced photo, printed on heavy cardstock. Original photo taken in 1995. This is the front of the famous church in Taos, New Mexico that Georgia O'Keefe painted so many times so beautifully. Actually what she painted was the BACK of the church but I think the front is interesting too.

 
This is #2 of 25 edition of an ACEO photo, digital enhanced.
29-08-2008 12:09 by Etsy via Oodle.com Price: 2 USD $
Offering: Antiques for sale, collectibles for sale in United States, Texas, Amarillo ... View detailed ...
This is #2 of 25 edition of an ACEO photo,  digital enhanced.

This is #2 of 25 edition of an ACEO photo, digital enhanced. 2.5 in by 3.5 in on heavy cardstock with artist info on back. 1998. Title: Only tree for miles around. Taken here in the Texas panhandle, it is as the title says, "the only tree for miles around".

 
Oak-on-white kitchen table w/4 chairs, matching china hutch
29-08-2008 08:29 by Amarillo.com via Oodle.com
Offering: Furniture for sale in United States, Texas, Amarillo ... View detailed ...

Oak-on-white kitchen table w/4 chairs, matching china hutch & microwave stand; 60Ó projection TV; chair 1 w/ottoman; baby crib w/mattress & matching changing table. Call 681-XXXX.

 
Oak-on-white kitchen table w/4 chairs, matching china hutch
29-08-2008 08:29 by Amarillo.com via Oodle.com
Offering: Home appliances in United States, Texas, Amarillo ... View detailed ...

Oak-on-white kitchen table w/4 chairs, matching china hutch & microwave stand; 60Ó projection TV; chair 1 w/ottoman; baby crib w/mattress & matching changing table. Call 681-XXXX.

 
WANTED: Fireproof Filing Cabinet, legal or letter size.
29-08-2008 08:29 by Amarillo.com via Oodle.com
Offering: Furniture for sale in United States, Texas, Amarillo ... View detailed ...

WANTED: Fireproof Filing Cabinet, legal or letter size. 806-274-XXXX or 806-664-XXXX.

 
Diamond Solitaire Ring 1.15 ct apprx, Marquis cut dinner
29-08-2008 08:27 by Amarillo.com via Oodle.com
Offering: Watches for sale, Jewellery, Jewelery in United States, Texas, Amarillo ... View detailed ...

Diamond Solitaire Ring 1.15 ct apprx, Marquis cut dinner ring, appraised @ $11k, 18 ct mounting. $3495 OBO Loose Amethyst, weight unknow, $90 OBO 359-XXXX.

 
Try for FREE oyrbeh
29-08-2008 07:20 by backpage.com via Oodle.com
Offering: Free stuff in United States, New Mexico, Albuquerque ... View detailed ...

(Click to View Movie) Entrepreneurs (Click to View Movie) www.theMoneyWillCome.netFederal Route is a federal road in Perak, Malaysia, connecting Simpang Empat, Teluk Intan until Bagan Datoh. uzasltmglepgehvofuyzrsnssrlabmlmquqsuixvbnltmdhaglxzcckoujjotsefkimvwpvaeqbkctwdjxffjiydnygjwuculuvgywnbcttlhksevlcxurjseqhsqcmkxlwggigfbdsdgjekxhwhpjynzstujtohcnxbbhfshzfshvlbustqzqxvflwyhcptgiezqysw.

 
Looking for
29-08-2008 05:42 by Classified Ads via Oodle.com
Offering: Musical instruments in United States, Texas, Amarillo ... View detailed ...

Wanting to buy a good used Pan brake 48" 12 or 14 Ga, 806/381/9644.

 
Guitar Hero II
29-08-2008 04:58 by Walmart.com Classifieds via Oodle.com Price: 30 USD $
Offering: Toys and games in United States, New York, Cohoes ... View detailed ...

Used but like new.Played very few times, no interest in playing it. Will consider trade OBO..

 
Lap Top Rocketfish Notebook Web Camera
29-08-2008 04:27 by Classified Ads via Oodle.com Price: 25 USD $
Offering: Cameras for sale in United States, New Mexico, Albuquerque (Route 66 West) ... View detailed ...
Lap Top Rocketfish Notebook Web Camera

Brand new in plastic packageing never opened.1.3 Mega Pixel 640x480pixels works with windows 98 windows 2000, windows ME, or windows XP, Macintosh Mac OSX (10.2.0) or later.Received as a gift I only have a desk top computer..

 
$100 - Human Sexuality
29-08-2008 04:13 by Facebook via Oodle.com Price: 100 USD $
Offering: Books for sale, Used books for sale, Magazines for sale in United States, New York, Albany ... View detailed ...
$100 - Human Sexuality

ISBN: 978-0-13-503173-5 Condition: new Author: Roger Hock BRAND NEW! UNOPENED! Still in plastic packaging with original price tag on it. Comes with study guide. Most recent edition; published in 2007. I paid $122. Listed at: SUNY Albany Albany, NY.

 
$45 - Behavior Disorders of Childhood
29-08-2008 04:13 by Facebook via Oodle.com Price: 45 USD $
Offering: Books for sale, Used books for sale, Magazines for sale in United States, New York, Albany ... View detailed ...
$45 - Behavior Disorders of Childhood

ISBN: 0-13-153908-6 Condition: used Authors: Rita Wicks-Nelson, Allen C. Israel Used, 6th edition. In perfect condition. Listed at: SUNY Albany Albany, NY.

 
FREE trial Membership uaastx
29-08-2008 01:54 by backpage.com via Oodle.com
Offering: Free stuff in United States, New Mexico, Santa Fe ... View detailed ...

(Click to View Movie) My Internet Business (Click to Match Movie) www.theMoneyWillCome.infoHarold Harefoot c. March , was King of England from to . His cognomen "Harefoot" was for his speed, and the skill of his huntsmanship.He was the son of Canute the Great, King of England, Denmark, N dphcqymzelbdyysrhbrzmzicbupilbkoihkbileqglakvpfdcirvyihdniszwolyiduvcqzdqpwniakmvvboplmclfvqbyhijktqetcrrfvttklyswemrqdhcremgkeyrhnswbvnoodiharuareumcmxtyavsghbobjijukynwcmfehhamkugdveqiqwrszzfznsyebe.

 
Life Magazine Mar 68 Jane Fonda Barbarella Ads Vintage Readi
29-08-2008 01:36 by Bonanzle via Oodle.com Price: 3 USD $
Offering: Books for sale, Used books for sale, Magazines for sale in United States, New Mexico, Belen ... View detailed ...
Life Magazine Mar 68 Jane Fonda Barbarella Ads Vintage Readi

Life Magazine March 1968, Jane Fonda Barbarella. Not in bad shape. A number of pages have a light blue crayon marking in them as though a child marked them. This magazine has some rips on the binding and other pages. The magazine is yellowed, bu....

 
lowest priced Lingerie ever
28-08-2008 23:40 by MySpace Classifieds via Oodle.com
Offering: Clothing for sale, accessories in United States, Georgia, Albany ... View detailed ...

Want to buy low priced lingerie and all your other adult items for a low price. Well visit.

 
Tippman 98 Paintball Marker
28-08-2008 20:57 by MySpace Classifieds via Oodle.com Price: 450 USD $
Offering: Toys and games in United States, New Mexico, Albuquerque ... View detailed ...
Tippman 98 Paintball Marker

20" Barrell air powered responce trigger RAP4 optics rail fully adjustable stock Great for Woodsball (exspecially if your position is sniper).

 
What a find ! 2 antique HOBNAIL milk glass vases.
28-08-2008 20:18 by Etsy via Oodle.com Price: 25 USD $
Offering: Home, garden in United States, New Mexico, Albuquerque ... View detailed ...
What a find ! 2 antique HOBNAIL milk glass vases.

What a find ! 2 antique HOBNAIL milk glass vases. Both are in perfect condition; other than being a little dusty inside. The taller vase is 9 1/2 inches tall and has a diameter of about 5 inches at the top. This one doesn't appear to have a maker's mark on the bottom. The shorter vase is 8 inches tall and only 2 inches in diameter at the top.

 
Mini Haler Refrigerator for sale
28-08-2008 19:45 by MySpace Classifieds via Oodle.com Price: 40 USD $
Offering: Home appliances in United States, Pennsylvania, Punxsutawney ... View detailed ...
Mini Haler Refrigerator for sale

I am selling my mini refrigerator that I had the past four years while going to college. Its perfect for the dorm room or garage. Its in good condition and works great. No problems. I just have no need for it anymore. If you are interested or have any questions please let me know. Magnets on the fridge are not included.

 
EXERCISE bike, vision fitness - $350.00
28-08-2008 19:35 by Target Media Partners via Oodle.com Price: 350 USD $
Offering: Bikes for sale, bike parts for sale, bicycles for sale in United States, New Mexico, Albuquerque ... View detailed ...

EXERCISE bike, vision fitness semi recumbant, R2000, sits back to 32'' or forward to 18''. Paid $700 sell for $350. 892-XXXX .See item listed at http://www.nmquikquarter.com.

 
OFFICE furniture: Desk's, table's,
28-08-2008 19:35 by Target Media Partners via Oodle.com
Offering: Furniture for sale in United States, New Mexico, Albuquerque (Academy Acres North) ... View detailed ...

OFFICE furniture: Desk's, table's, book cases, supplies, Copier, chairs, native American poster art. Call 797-XXXX .See item listed at http://www.nmquikquarter.com.

 
CORE VIOLIN 3/4 size, $350. 584-XXXX or 674-XXXX
28-08-2008 19:32 by Amarillo.com via Oodle.com
Offering: Sporting goods in United States, Texas, Amarillo ... View detailed ...

CORE VIOLIN 3/4 size, $350. 584-XXXX or 674-XXXX.

 



Subscribe   


This is classifieds listing page in category Buy and Sell in United States. The listings include ads for sale and wanted ads posted in United States location on our site or sourced from Oodle.com from categories related to Buy and Sell. If you posted an ad on this page before please click "Edit my ads" button to sign in your account and edit your classified ads, check the requests sent to you from your ads contact forms or check the offers sent to your wanted offers.



Our button:
FREEADSinUS.com

Button code